Anti-SLC1A2 antibody produced in rabbit | MilliporeSigma SAB2102171 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-SLC1A2 antibody produced in rabbit

catalog :

SAB2102171

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, chicken, zebrafish

application :

western blot, immunocytochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; mouse; loading ...; fig 1b	Velandia Romero M, Calderón Peláez M, Castellanos J. In Vitro Infection with Dengue Virus Induces Changes in the Structure and Function of the Mouse Brain Endothelium. PLoS ONE. 2016;11:e0157786 pubmed publisher

product information

cat no :

SAB2102171

brand :

SIGMA

name :

Anti-SLC1A2 antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

syns :

Anti-EAAT2; Anti-GLT-1; Anti-Solute carrier family 1 (glial high affinity glutamate transporter), member 2

mdl no :

MFCD01092543

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

chicken, canine, human, mouse, rat, zebrafish

immunogen :

Peptide region of the protein sequence according to NP_004162.

immunogen sequence :

PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQ
ACFQQIQTVTK

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.