Anti-GAPDH antibody produced in rabbit | MilliporeSigma SAB2100894 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-GAPDH antibody produced in rabbit

catalog :

SAB2100894

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs

application :

western blot

citations: 3

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:10,000; fig 1	Pecze L, Jósvay K, Blum W, Petrovics G, Vizler C, Olah Z, et al. Activation of endogenous TRPV1 fails to induce overstimulation-based cytotoxicity in breast and prostate cancer cells but not in pain-sensing neurons. Biochim Biophys Acta. 2016;1863:2054-64 pubmed publisher
	Li Y, Chang Y, Ye N, Dai D, Chen Y, Zhang N, et al. Advanced Glycation End Products Inhibit the Proliferation of Human Umbilical Vein Endothelial Cells by Inhibiting Cathepsin D. Int J Mol Sci. 2017;18: pubmed publisher
	Zhang J, Guo L, Zhou X, Dong F, Li L, Cheng Z, et al. Dihydroartemisinin induces endothelial cell anoikis through the activation of the JNK signaling pathway. Oncol Lett. 2016;12:1896-1900 pubmed

product information

cat no :

SAB2100894

brand :

SIGMA

name :

Anti-GAPDH antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

syns :

Anti-G3PD; Anti-GAPD; Anti-Glyceraldehyde-3-phosphate dehydrogenase; Anti-MGC88685

mdl no :

MFCD01322099

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

canine, human, rat, mouse

immunogen :

Peptide region of the protein sequence according to NP_002037.

immunogen sequence :

PFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPI
TIFQERDPSKI

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.