Anti-DCN (ab2) antibody produced in rabbit | MilliporeSigma SAB2100540 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-DCN (ab2) antibody produced in rabbit

catalog :

SAB2100540

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, chicken, bovine

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; fig 3c	Barallobre Barreiro J, Gupta S, Zoccarato A, Kitazume Taneike R, Fava M, Yin X, et al. Glycoproteomics Reveals Decorin Peptides With Anti-Myostatin Activity in Human Atrial Fibrillation. Circulation. 2016;134:817-32 pubmed publisher

product information

cat no :

SAB2100540

brand :

SIGMA

name :

Anti-DCN (ab2) antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

syns :

Anti-CSCD; Anti-DSPG2; Anti-Decorin; Anti-PG40; Anti-PGII

mdl no :

MFCD00282305

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

mouse, canine, human, bovine, rabbit, chicken, pig

immunogen :

Peptide region of the protein sequence according to NP_001911.

immunogen sequence :

IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDK
VPKDLPPDTTL

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.