Anti-CRLF1 antibody produced in rabbit | MilliporeSigma SAB2100484 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-CRLF1 antibody produced in rabbit

catalog :

SAB2100484

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, zebrafish

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:1000; loading ...; fig s2a	Chaudhury A, Cheema S, Fachini J, Kongchan N, Lu G, Simon L, et al. CELF1 is a central node in post-transcriptional regulatory programmes underlying EMT. Nat Commun. 2016;7:13362 pubmed publisher

product information

cat no :

SAB2100484

brand :

SIGMA

name :

Anti-CRLF1 antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

syns :

Anti-CISS; Anti-CLF; Anti-Cytokine receptor-like factor 1

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

zebrafish, human, mouse, rat

immunogen :

Peptide region of the protein sequence according to NP_004741.

immunogen sequence :

QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDV
SNQTSCRLAGL

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.