This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-CDC42 antibody produced in rabbit
catalog :
SAB2100382
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, dog, chicken
application :
western blot
product information
cat no :
SAB2100382
brand :
SIGMA
name :
Anti-CDC42 antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
syns :
Anti-CDC42Hs; Anti-Cell division cycle 42 (GTP binding protein, 25kDa); Anti-G25K
mdl no :
MFCD01092310
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
canine, chicken, human, mouse, rat
immunogen :
Peptide region of the protein sequence according to NP_001782.
immunogen sequence :
VFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQ
TDVFLVCFSVV
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA