Anti-BACH2 antibody produced in rabbit | MilliporeSigma SAB2100201 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-BACH2 antibody produced in rabbit

catalog :

SAB2100201

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot, chromatin immunoprecipitation

citations: 1

Published Application/Species/Sample/Dilution	Reference
chromatin immunoprecipitation; mouse; loading ...; fig 4b	Kuwahara M, Ise W, Ochi M, Suzuki J, Kometani K, Maruyama S, et al. Bach2-Batf interactions control Th2-type immune response by regulating the IL-4 amplification loop. Nat Commun. 2016;7:12596 pubmed publisher

product information

cat no :

SAB2100201

brand :

SIGMA

name :

Anti-BACH2 antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

syns :

Anti-BTB and CNC homology 1, basic leucine zipper transcription factor 2

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

bovine, human, mouse, rat

immunogen :

Peptide region of the protein sequence according to NP_068585.

immunogen sequence :

SGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKC
TTDEQPRKDYT

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.