This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-CRK antibody produced in mouse
catalog :
SAB1405658
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
citations: 1
product information
cat no :
SAB1405658
brand :
SIGMA
name :
Anti-CRK antibody produced in mouse
prod type :
Chemical
name suffix :
purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Clear, colorless solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
general description :
Mouse polyclonal antibody raised against a full-length human CRK protein.
ncbi accession no :
NM_005206
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
western blot: suitable
species reactivity :
human
concentration :
~0.1 mg/mL
immunogen :
CRK (NP_005197.3, 1 a.a. ~ 204 a.a) full-length human protein.
immunogen sequence :
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRD
SSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQP
PPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEP
VSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKG
DILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASA
SVSALIGGR
SSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQP
PPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEP
VSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKG
DILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASA
SVSALIGGR
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
mol wt :
antigen mol wt ~22.9 kDa
company information

MilliporeSigma
questions and comments
