This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Monoclonal Anti-PPARBP antibody produced in mouse
catalog :
SAB1404231
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G3
reactivity :
human
application :
western blot
product information
cat no :
SAB1404231
brand :
SIGMA
name :
Monoclonal Anti-PPARBP antibody produced in mouse
prod type :
Chemical
name suffix :
clone 1G3, purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Clear, colorless solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
general description :
Mouse monoclonal antibody raised against a partial recombinant PPARBP.
ncbi accession no :
NM_004774
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
capture ELISA: suitable; western blot: suitable; indirect ELISA: suitable
species reactivity :
human
concentration :
~0.5 mg/mL
immunogen :
PPARBP (NP_004765, 1391 a.a. ~ 1491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
clone :
1G3
immunogen sequence :
KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSK
NYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESG
SSIAEKSYQNSPSSDDGIRPLP*
NYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESG
SSIAEKSYQNSPSSDDGIRPLP*
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
mol wt :
antigen mol wt ~37.11 kDa
company information

MilliporeSigma
questions and comments
