This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Monoclonal Anti-RNF13 antibody produced in mouse
catalog :
SAB1403112
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3E4
reactivity :
human
application :
western blot
product information
cat no :
SAB1403112
brand :
SIGMA
name :
Monoclonal Anti-RNF13 antibody produced in mouse
prod type :
Chemical
name suffix :
clone 3E4, purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Clear, colorless solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
general description :
Mouse monoclonal antibody raised against a partial recombinant RNF13.
ncbi accession no :
NM_007282
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
western blot: suitable; capture ELISA: suitable; indirect ELISA: suitable
species reactivity :
human
concentration :
~1 mg/mL
immunogen :
RNF13 (NP_009213, 51 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
clone :
3E4
immunogen sequence :
LPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNS
SGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDD
LISMGSNDIEVLKKIDIPSVFI*
SGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDD
LISMGSNDIEVLKKIDIPSVFI*
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
mol wt :
antigen mol wt ~37.11 kDa
company information

MilliporeSigma
questions and comments
