Monoclonal Anti-S100B antibody produced in mouse | MilliporeSigma SAB1402349 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Monoclonal Anti-S100B antibody produced in mouse

catalog :

SAB1402349

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1B2

reactivity :

human, mouse

application :

western blot, immunohistochemistry

citations: 5

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; mouse; 1:200; loading ...; fig s8c	Paez Gonzalez P, Asrican B, Rodriguez E, Kuo C. Identification of distinct ChAT? neurons and activity-dependent control of postnatal SVZ neurogenesis. Nat Neurosci. 2014;17:934-42 pubmed publisher
	Abdi K, Neves G, Pyun J, Kiziltug E, Ahrens A, Kuo C. EGFR Signaling Termination via Numb Trafficking in Ependymal Progenitors Controls Postnatal Neurogenic Niche Differentiation. Cell Rep. 2019;28:2012-2022.e4 pubmed publisher
	Wu L, Wang J, Conidi A, Zhao C, Wang H, Ford Z, et al. Zeb2 recruits HDAC-NuRD to inhibit Notch and controls Schwann cell differentiation and remyelination. Nat Neurosci. 2016;19:1060-72 pubmed publisher
	Logan C, Cossins J, RodrÃguez Cruz P, Parry D, Maxwell S, MartÃnez MartÃnez P, et al. Congenital Myasthenic Syndrome Type 19 Is Caused by Mutations in COL13A1, Encoding the Atypical Non-fibrillar Collagen Type XIII Î±1 Chain. Am J Hum Genet. 2015;97:878-85 pubmed publisher
	Sen E, Basu A, Willing L, Uliasz T, Myrkalo J, Vannucci S, et al. Pre-conditioning induces the precocious differentiation of neonatal astrocytes to enhance their neuroprotective properties. ASN Neuro. 2011;3:e00062 pubmed publisher

product information

cat no :

SAB1402349

brand :

SIGMA

name :

Monoclonal Anti-S100B antibody produced in mouse

prod type :

Chemical

name suffix :

clone 1B2, purified immunoglobulin, buffered aqueous solution

storage :

-20C

storage temp :

-20C

physical form :

Clear, colorless solution in phosphate buffered saline, pH 7.2

shipped in :

dry ice

general description :

Mouse monoclonal antibody raised against a partial recombinant S100B.

ncbi accession no :

NM_006272

form :

buffered aqueous solution

antibody form :

purified immunoglobulin

application(s) :

western blot: suitable; indirect ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

concentration :

~0.5 mg/mL

immunogen :

S100B (NP_006263, 1 a.a. - 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. The immunogen sequence given is from the full length of NP_006263.

clone :

1B2

immunogen sequence :

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINN
ELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFV
AMVTTACHEFFEHE*

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

mol wt :

antigen mol wt ~36.23 kDa