Anti-SRSF7 antibody produced in rabbit | MilliporeSigma HPA043850 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-SRSF7 antibody produced in rabbit

catalog :

HPA043850

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; human; 1:1000; fig 1 western blot; human; 1:1000; fig 1	Park W, Kim H, Kang D, Ryu J, Choi K, Lee G, et al. Comparative expression patterns and diagnostic efficacies of SR splicing factors and HNRNPA1 in gastric and colorectal cancer. BMC Cancer. 2016;16:358 pubmed publisher

product information

cat no :

HPA043850

brand :

SIGMA

name :

Anti-SRSF7 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-9G8; Anti-AAG3; Anti-HSSG1; Anti-RBM37; Anti-SFRS7; Anti-Serine/Arginine-Rich Splicing Factor 7; Anti-ZCCHC20; Anti-ZCRB2

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

serine/arginine-rich splicing factor 7 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGE

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies