Anti-ARHGAP11A antibody produced in rabbit | MilliporeSigma HPA040419 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-ARHGAP11A antibody produced in rabbit

catalog :

HPA040419

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

immunohistochemistry, immunohistochemistry - paraffin section

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; human; fig 5	Andersson E, Arvidsson Y, SwÃ¤rd C, Hofving T, WÃ¤ngberg B, Kristiansson E, et al. Expression profiling of small intestinal neuroendocrine tumors identifies subgroups with clinical relevance, prognostic markers and therapeutic targets. Mod Pathol. 2016;29:616-29 pubmed publisher

product information

cat no :

HPA040419

brand :

SIGMA

name :

Anti-ARHGAP11A antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Kiaa0013; Anti-Rho gtpase activating protein 11a

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

Rho GTPase activating protein 11A recombinant protein epitope signature tag (PrEST)

immunogen sequence :

DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETP
GEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQ
LSESPVILTPNAKRT

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.