Anti-RHOG antibody produced in rabbit | MilliporeSigma HPA039871 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-RHOG antibody produced in rabbit

catalog :

HPA039871

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, immunohistochemistry, flow cytometry

citations: 1

Published Application/Species/Sample/Dilution	Reference
flow cytometry; rat; loading ...; fig 4b immunohistochemistry; rat; loading ...; fig 1b western blot; rat; loading ...; fig 1a western blot; human; loading ...; fig 7a	Ubba V, Soni U, Chadchan S, Maurya V, Kumar V, Maurya R, et al. RHOG-DOCK1-RAC1 Signaling Axis Is Perturbed in DHEA-Induced Polycystic Ovary in Rat Model. Reprod Sci. 2017;24:738-752 pubmed publisher

product information

cat no :

HPA039871

brand :

SIGMA

name :

Anti-RHOG antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-ARHG; Anti-MGC125835; Anti-MGC125836; Anti-Ras homolog gene family, member G (rho G)

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable; protein array: suitable

species reactivity :

human

immunogen :

ras homolog gene family, member G (rho G) recombinant protein epitope signature tag (PrEST)

immunogen sequence :

KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.