Anti-PDIA6 antibody produced in rabbit | MilliporeSigma HPA034653 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-PDIA6 antibody produced in rabbit

catalog :

HPA034653

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; 1:50; loading ...; fig 4a western blot; human; 1:1000; loading ...; fig 1c	Bromfield E, McLaughlin E, Aitken R, Nixon B. Heat Shock Protein member A2 forms a stable complex with angiotensin converting enzyme and protein disulfide isomerase A6 in human spermatozoa. Mol Hum Reprod. 2016;22:93-109 pubmed publisher

product information

cat no :

HPA034653

brand :

SIGMA

name :

Anti-PDIA6 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-ERp5; Anti-P5; Anti-TXNDC7; Anti-protein disulfide isomerase family A, member 6

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

protein disulfide isomerase family A, member 6 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

GWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKFAL
LKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVERE
PWDGRDGELPVEDDIDLSDV

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.