This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-ABCD3 antibody produced in rabbit
catalog :
HPA032027
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
citations: 2
Published Application/Species/Sample/DilutionReference
  • immunocytochemistry; human; loading ...; fig 5
Assadi G, Vesterlund L, Bonfiglio F, Mazzurana L, Cordeddu L, Schepis D, et al. Functional Analyses of the Crohn's Disease Risk Gene LACC1. PLoS ONE. 2016;11:e0168276 pubmed publisher
  • immunohistochemistry - paraffin section; rat; fig 3
Luks L, Sacchi S, Pollegioni L, Dietrich D. Novel insights into renal D-amino acid oxidase accumulation: propiverine changes DAAO localization and peroxisomal size in vivo. Arch Toxicol. 2017;91:427-437 pubmed publisher
product information
cat no :
HPA032027
brand :
SIGMA
name :
Anti-ABCD3 antibody produced in rabbit
prod type :
Chemical
name suffix :
Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
legal information :
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
shipped in :
wet ice
syns :
Anti-ATP-binding cassette, sub-family D (ALD), member 3; Anti-PMP70; Anti-PXMP1
mdl no :
MFCD01865555
form :
buffered aqueous glycerol solution
antibody form :
affinity isolated antibody
application(s) :
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; protein array: suitable
species reactivity :
human
immunogen :
ATP-binding cassette, sub-family D (ALD), member 3 recombinant protein epitope signature tag (PrEST)
immunogen sequence :
VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRG
NYEFKQITEDTVEFGS
grade :
Prestige Antibodies(R) Powered by Atlas Antibodies
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA