Anti-GATA3 antibody produced in rabbit | MilliporeSigma HPA029731 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-GATA3 antibody produced in rabbit

catalog :

HPA029731

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; 1:200; loading ...; fig 2e	Hosoya M, Fujioka M, Sone T, Okamoto S, Akamatsu W, Ukai H, et al. Cochlear Cell Modeling Using Disease-Specific iPSCs Unveils a Degenerative Phenotype and Suggests Treatments for Congenital Progressive Hearing Loss. Cell Rep. 2017;18:68-81 pubmed publisher
immunohistochemistry - paraffin section; human; 1:100; loading ...; fig 5c	Strietz J, Stepputtis S, Preca B, Vannier C, Kim M, Castro D, et al. ERN1 and ALPK1 inhibit differentiation of bi-potential tumor-initiating cells in human breast cancer. Oncotarget. 2016;7:83278-83293 pubmed publisher

product information

cat no :

HPA029731

brand :

SIGMA

name :

Anti-GATA3 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-GATA binding protein 3; Anti-HDR

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable

species reactivity :

human

immunogen :

GATA binding protein 3 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

MKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPA
ALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPH
HP

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.