Anti-CSNK1E antibody produced in rabbit | MilliporeSigma HPA026288 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-CSNK1E antibody produced in rabbit

catalog :

HPA026288

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig 5a	Kuga T, Kume H, Adachi J, Kawasaki N, Shimizu M, Hoshino I, et al. Casein kinase 1 is recruited to nuclear speckles by FAM83H and SON. Sci Rep. 2016;6:34472 pubmed publisher
western blot; human; fig 3h immunohistochemistry; mouse; loading ...; fig 1a	Kuga T, Sasaki M, Mikami T, Miake Y, Adachi J, Shimizu M, et al. FAM83H and casein kinase I regulate the organization of the keratin cytoskeleton and formation of desmosomes. Sci Rep. 2016;6:26557 pubmed publisher

product information

cat no :

HPA026288

brand :

SIGMA

name :

Anti-CSNK1E antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-CKI-epsilon; Anti-CKIe; Anti-Casein kinase I isoform epsilon

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable; protein array: suitable

species reactivity :

human

immunogen :

Casein kinase I isoform epsilon recombinant protein epitope signature tag (PrEST)

immunogen sequence :

NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALP
PGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.