Anti-RAB3GAP2 antibody produced in rabbit | MilliporeSigma HPA026273 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-RAB3GAP2 antibody produced in rabbit

catalog :

HPA026273

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

immunohistochemistry, western blot knockout validation

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; mouse; loading ...; fig 5f	Xu D, Li Y, Wu L, Li Y, Zhao D, Yu J, et al. Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions. J Cell Biol. 2018;217:975-995 pubmed publisher

product information

cat no :

HPA026273

brand :

SIGMA

name :

Anti-RAB3GAP2 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-RAB3-GAP150; Anti-RGAP-iso; Anti-Rab3 GTPase-activating protein 150 kDa subunit; Anti-Rab3 GTPase-activating protein non-catalytic subunit; Anti-Rab3-GAP p150; Anti-Rab3-GAP regulatory subunit

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; indirect immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

Rab3 GTPase-activating protein non-catalytic subunit recombinant protein epitope signature tag (PrEST)

immunogen sequence :

TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRA
CRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHAS
VGIMTLSPFDQMKTA

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.