Anti-IFT20 antibody produced in rabbit | MilliporeSigma HPA021376 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-IFT20 antibody produced in rabbit

catalog :

HPA021376

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs

application :

immunohistochemistry, immunocytochemistry

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; mouse; 1:200; loading ...; fig 4 immunocytochemistry; human; 1:200; loading ...; fig 6	Hua K, Ferland R. Fixation methods can differentially affect ciliary protein immunolabeling. Cilia. 2017;6:5 pubmed publisher
immunocytochemistry; dogs; 1:200; loading ...; fig 1c	BernabÃ© Rubio M, AndrÃ©s G, Casares Arias J, FernÃ¡ndez Barrera J, Rangel L, Reglero Real N, et al. Novel role for the midbody in primary ciliogenesis by polarized epithelial cells. J Cell Biol. 2016;214:259-73 pubmed publisher

product information

cat no :

HPA021376

brand :

SIGMA

name :

Anti-IFT20 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Intraflagellar transport protein 20 homolog; Anti-hIFT20

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

Intraflagellar transport protein 20 homolog recombinant protein epitope signature tag (PrEST)

immunogen sequence :

MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHF
DELNKLRVLDPEVTQQTIELKEECKDFVDK

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies