Anti-MRPL10 antibody produced in rabbit | MilliporeSigma HPA021234 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-MRPL10 antibody produced in rabbit

catalog :

HPA021234

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunoprecipitation

citations: 3

Published Application/Species/Sample/Dilution	Reference
western blot; human; fig 3g	Maiti P, Kim H, Tu Y, Barrientos A. Human GTPBP10 is required for mitoribosome maturation. Nucleic Acids Res. 2018;46:11423-11437 pubmed publisher
immunoprecipitation; human; loading ...; fig 3e western blot; human; loading ...; fig 1, 2c, 3e, 4e	Li H, Wang R, Jiang H, Zhang E, Tan J, Xu H, et al. Mitochondrial Ribosomal Protein L10 Associates with Cyclin B1/Cdk1 Activity and Mitochondrial Function. DNA Cell Biol. 2016;35:680-690 pubmed
western blot; human; fig 4	Nouws J, Goswami A, Bestwick M, McCann B, Surovtseva Y, Shadel G. Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import. J Biol Chem. 2016;291:989-97 pubmed publisher

product information

cat no :

HPA021234

brand :

SIGMA

name :

Anti-MRPL10 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-39S ribosomal protein L10, mitochondrial; Anti-L10mt; Anti-MRP-L10; Anti-MRP-L8

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; indirect immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

39S ribosomal protein L10, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)

immunogen sequence :

NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSK
YQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLG
GC

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies