Anti-ELMO1 antibody produced in rabbit | MilliporeSigma HPA017941 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-ELMO1 antibody produced in rabbit

catalog :

HPA017941

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, flow cytometry

citations: 1

Published Application/Species/Sample/Dilution	Reference
flow cytometry; rat; loading ...; fig 4c western blot; rat; loading ...; fig 3c western blot; mouse; loading ...; fig 7c	Ubba V, Soni U, Chadchan S, Maurya V, Kumar V, Maurya R, et al. RHOG-DOCK1-RAC1 Signaling Axis Is Perturbed in DHEA-Induced Polycystic Ovary in Rat Model. Reprod Sci. 2017;24:738-752 pubmed publisher

product information

cat no :

HPA017941

brand :

SIGMA

name :

Anti-ELMO1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-CED-12 homolog; Anti-Engulfment and cell motility protein 1

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

Engulfment and cell motility protein 1 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

QTLDTPSLRTVTLTVRVHGFILEVSKTKNPPIPDTFWPP
RWDHRPSPGGETNAYCQMNHVNPAMDFTQTPPGMLALDN
MLYFAKH

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies