Anti-LETM1 antibody produced in rabbit | MilliporeSigma HPA011029 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-LETM1 antibody produced in rabbit

catalog :

HPA011029

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, other

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig 4d	Lee J, Lee W, Seol M, Lee S, Kim D, Kim H, et al. Coupling of LETM1 up-regulation with oxidative phosphorylation and platelet-derived growth factor receptor signaling via YAP1 transactivation. Oncotarget. 2016;7:66728-66739 pubmed publisher
other; human; loading ...; fig st1	Kanderová V, Kuzilkova D, Stuchly J, Vaskova M, Brdicka T, Fiser K, et al. High-resolution Antibody Array Analysis of Childhood Acute Leukemia Cells. Mol Cell Proteomics. 2016;15:1246-61 pubmed publisher

product information

cat no :

HPA011029

brand :

SIGMA

name :

Anti-LETM1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Ab2, Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Leucine zipper-EF-hand-containing transmembrane protein 1, mitochondrial precursor

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; western blot: suitable

species reactivity :

human

immunogen :

LETM1 and EF-hand domain-containing protein 1, mitochondrial Precursor (Leucine zipper-EF-hand-containing transmembrane protein 1)

immunogen sequence :

SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMD
QQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKL
TSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQV
AEIVATLE

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.