Anti-MLF2 antibody produced in rabbit | MilliporeSigma HPA010811 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-MLF2 antibody produced in rabbit

catalog :

HPA010811

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; mouse; 1:1000; loading ...; fig 2a	Schludi M, Becker L, Garrett L, Gendron T, Zhou Q, Schreiber F, et al. Spinal poly-GA inclusions in a C9orf72 mouse model trigger motor deficits and inflammation without neuron loss. Acta Neuropathol. 2017;134:241-254 pubmed publisher

product information

cat no :

HPA010811

brand :

SIGMA

name :

Anti-MLF2 antibody produced in rabbit

prod type :

Chemical

name suffix :

Ab1, Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Myelodysplasia-myeloid leukemia factor 2 antibody produced in rabbit; Anti-Myeloid leukemia factor 2 antibody produced in rabbit

unspsc code :

12352203

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable; protein array: suitable

species reactivity :

human

immunogen :

Myeloid leukemia factor 2 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSP
FLSITDGNMPGTRPASRRMQQA

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.