Anti-SEC31A antibody produced in rabbit | MilliporeSigma HPA005457 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-SEC31A antibody produced in rabbit

catalog :

HPA005457

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

immunohistochemistry, immunocytochemistry

citations: 3

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; 1:500; fig 4	Jansen J, Cirak S, van Scherpenzeel M, Timal S, Reunert J, Rust S, et al. CCDC115 Deficiency Causes a Disorder of Golgi Homeostasis with Abnormal Protein Glycosylation. Am J Hum Genet. 2016;98:310-21 pubmed publisher
immunocytochemistry; human; 1:500; fig 4	Jansen J, Timal S, van Scherpenzeel M, Michelakakis H, Vicogne D, Ashikov A, et al. TMEM199 Deficiency Is a Disorder of Golgi Homeostasis Characterized by Elevated Aminotransferases, Alkaline Phosphatase, and Cholesterol and Abnormal Glycosylation. Am J Hum Genet. 2016;98:322-30 pubmed publisher
	Chierico L, Rizzello L, Guan L, Joseph A, Lewis A, Battaglia G. The role of the two splice variants and extranuclear pathway on Ki-67 regulation in non-cancer and cancer cells. PLoS ONE. 2017;12:e0171815 pubmed publisher

product information

cat no :

HPA005457

brand :

SIGMA

name :

Anti-SEC31A antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-SEC31 homolog A isoform 4 antibody produced in rabbit

unspsc code :

12352203

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; protein array: suitable

species reactivity :

human

immunogen :

SEC31 homolog A isoform 4 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

NWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQT
QACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVV
ILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIA
AALAFLPDNTNQPNIMQLR

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies