Anti-HNF4G antibody produced in rabbit | MilliporeSigma HPA005438 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-HNF4G antibody produced in rabbit

catalog :

HPA005438

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

Dictyostelium discoideum, human

application :

immunohistochemistry, ChIP-Seq

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; human; 1:50; loading ...; fig 7a ChIP-Seq; Dictyostelium discoideum; loading ...; fig 7e	Shukla S, Cyrta J, Murphy D, Walczak E, Ran L, Agrawal P, et al. Aberrant Activation of a Gastrointestinal Transcriptional Circuit in Prostate Cancer Mediates Castration Resistance. Cancer Cell. 2017;32:792-806.e7 pubmed publisher
	Lindeboom R, van Voorthuijsen L, Oost K, Rodríguez Colman M, Luna Velez M, Furlan C, et al. Integrative multi-omics analysis of intestinal organoid differentiation. Mol Syst Biol. 2018;14:e8227 pubmed publisher

product information

cat no :

HPA005438

brand :

SIGMA

name :

Anti-HNF4G antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-HNF-4-gamma; Anti-Hepatocyte nuclear factor 4-gamma; Anti-Nuclear receptor subfamily 2 group A member 2

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

Hepatocyte nuclear factor 4-gamma recombinant protein epitope signature tag (PrEST)

immunogen sequence :

WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHH
PMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPS
PPQGSGQEQYKIAANQASVISHQHLSKQKQ

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies