Anti-CXADR antibody produced in rabbit | MilliporeSigma HPA003342 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-CXADR antibody produced in rabbit

catalog :

HPA003342

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, pigs

application :

western blot, immunohistochemistry, immunocytochemistry, proximity ligation assay

citations: 2

Published Application/Species/Sample/Dilution	Reference
proximity ligation assay; pigs ; 1:100; fig 5 immunocytochemistry; pigs ; 1:100; fig 3	Kwon J, Jeong S, Choi I, Kim N. ADAM10 Is Involved in Cell Junction Assembly in Early Porcine Embryo Development. PLoS ONE. 2016;11:e0152921 pubmed publisher
immunocytochemistry; rat; 1:50; fig 1 western blot; human; 1:300; fig 2	Valcourt U, Carthy J, Okita Y, Alcaraz L, Kato M, Thuault S, et al. Analysis of Epithelial-Mesenchymal Transition Induced by Transforming Growth Factor Î². Methods Mol Biol. 2016;1344:147-81 pubmed publisher

product information

cat no :

HPA003342

brand :

SIGMA

name :

Anti-CXADR antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-CVB3-binding protein antibody produced in rabbit; Anti-Coxsackievirus B-adenovirus receptor antibody produced in rabbit; Anti-Coxsackievirus and adenovirus receptor precursor antibody produced in rabbit; Anti-HCVADR antibody produced in rabbit; Anti-hCAR antibody produced in rabbit

unspsc code :

12352203

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

Coxsackievirus and adenovirus receptor precursor recombinant protein epitope signature tag (PrEST)

immunogen sequence :

ITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS
PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLK
SGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVL
VKPSGARCYVDGSEEIGSDFKI

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.