Anti-DICER1 antibody produced in rabbit | MilliporeSigma HPA000694 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-DICER1 antibody produced in rabbit

catalog :

HPA000694

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

citations: 3

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; human; 1:50; loading ...; fig 5a western blot; human; 1:500; loading ...; fig 2	Spoelstra N, Cittelly D, Christenson J, Gordon M, Elias A, Jedlicka P, et al. Dicer expression in estrogen receptor-positive versus triple-negative breast cancer: an antibody comparison. Hum Pathol. 2016;56:40-51 pubmed publisher
western blot; human; 1:500; fig s1	Francia S, Cabrini M, Matti V, Oldani A, d Adda di Fagagna F. DICER, DROSHA and DNA damage response RNAs are necessary for the secondary recruitment of DNA damage response factors. J Cell Sci. 2016;129:1468-76 pubmed publisher
	Jafarnejad S, Ardekani G, Ghaffari M, Martinka M, Li G. Sox4-mediated Dicer expression is critical for suppression of melanoma cell invasion. Oncogene. 2013;32:2131-9 pubmed publisher

product information

cat no :

HPA000694

brand :

SIGMA

name :

Anti-DICER1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Endoribonuclease Dicer antibody produced in rabbit; Anti-Helicase with RNase motif antibody produced in rabbit; Anti-Helicase-MOI antibody produced in rabbit

unspsc code :

12352203

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

Endoribonuclease Dicer recombinant protein epitope signature tag (PrEST)

immunogen sequence :

PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARI
GIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFY
VADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQ
PLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKW
ESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies