This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-SULF2 antibody produced in rabbit
catalog :
AV49338
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, chicken, bovine
application :
western blot, immunohistochemistry
product information
cat no :
AV49338
brand :
SIGMA
name :
Anti-SULF2 antibody produced in rabbit
prod type :
Chemical
name suffix :
IgG fraction of antiserum, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_061325
syns :
Anti-DKFZp313E091; Anti-FLJ90554; Anti-HSULF-2; Anti-KIAA1247; Anti-MGC126411; Anti-Sulfatase 2
form :
lyophilized powder
antibody form :
IgG fraction of antiserum
application(s) :
western blot: suitable; immunohistochemistry: suitable
species reactivity :
canine, bovine, human, mouse, rat, chicken,
immunogen :
synthetic peptide corresponding to a region of human SULF2 with an internal ID of P29073
immunogen sequence :
QCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSK
SLGQLWEGWEG
SLGQLWEGWEG
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information

MilliporeSigma
questions and comments
