Anti-STEAP3 (AB1) antibody produced in rabbit | MilliporeSigma AV43515 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-STEAP3 (AB1) antibody produced in rabbit

catalog :

AV43515

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; 1:3000; fig 3	Gasperini L, Meneghetti E, Legname G, Benetti F. In Absence of the Cellular Prion Protein, Alterations in Copper Metabolism and Copper-Dependent Oxidase Activity Affect Iron Distribution. Front Neurosci. 2016;10:437 pubmed

product information

cat no :

AV43515

brand :

SIGMA

name :

Anti-STEAP3 (AB1) antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_001008410

syns :

Anti-Dudlin-2; Anti-STEAP family member 3; Anti-STMP3; Anti-TSAP6

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

human, mouse, rat

immunogen :

synthetic peptide corresponding to a region of human STEAP3 with an internal ID of Y01350

immunogen sequence :

SSLGFVALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTL
TLLVPCVVILA

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.