Anti-WWP2 (AB1) antibody produced in rabbit | MilliporeSigma AV43088 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-WWP2 (AB1) antibody produced in rabbit

catalog :

AV43088

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, chicken, bovine, zebrafish

application :

western blot, immunohistochemistry, other

citations: 1

Published Application/Species/Sample/Dilution	Reference
other; human; loading ...; fig st1	Kanderová V, Kuzilkova D, Stuchly J, Vaskova M, Brdicka T, Fiser K, et al. High-resolution Antibody Array Analysis of Childhood Acute Leukemia Cells. Mol Cell Proteomics. 2016;15:1246-61 pubmed publisher

product information

cat no :

AV43088

brand :

SIGMA

name :

Anti-WWP2 (AB1) antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_008945

syns :

Anti-AIP2; Anti-WW domain containing E3 Ubiquitin protein ligase 2

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry: suitable; western blot: suitable

species reactivity :

bovine, canine, mouse, zebrafish, chicken, human, rat

immunogen :

synthetic peptide corresponding to a region of human WWP2 with an internal ID of P25063

immunogen sequence :

RTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYHQFRFLC
HSNALPSHVKI

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.