Anti-UBE2I (AB1) antibody produced in rabbit | MilliporeSigma AV43021 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-UBE2I (AB1) antibody produced in rabbit

catalog :

AV43021

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, chicken, bovine, zebrafish , purple urchin

application :

western blot, immunocytochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; purple urchin; 1:100; fig s6	Oulhen N, Wessel G. Differential Nanos 2 protein stability results in selective germ cell accumulation in the sea urchin. Dev Biol. 2016;418:146-156 pubmed publisher

product information

cat no :

AV43021

brand :

SIGMA

name :

Anti-UBE2I (AB1) antibody produced in rabbit

prod type :

Chemical

name suffix :

IgG fraction of antiserum, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_919235

syns :

Anti-C358B7.1; Anti-P18; Anti-UBC9; Anti-Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast)

form :

lyophilized powder

antibody form :

IgG fraction of antiserum

application(s) :

western blot: suitable

species reactivity :

, bovine, zebrafish, chicken, human, mouse, rat, canine

immunogen :

synthetic peptide corresponding to a region of human UBE2I with an internal ID of P11592

immunogen sequence :

SGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMN
WECAIPGKKGT

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.