This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-MKI67IP antibody produced in rabbit
catalog :
AV41054
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
cat no :
AV41054
brand :
SIGMA
name :
Anti-MKI67IP antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_115766
syns :
Anti-MKI67 (FHA domain) interacting nucleolar phosphoprotein; Anti-NIFK; Anti-Nopp34
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
human, mouse, pig, canine, rat, bovine
immunogen :
synthetic peptide corresponding to a region of human MKI67IP with an internal ID of S02402
immunogen sequence :
PSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGID
YDFPSLILQKT
YDFPSLILQKT
company information

MilliporeSigma
questions and comments
