This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-GRSF1 antibody produced in rabbit
catalog :
AV40382
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, bovine
application :
western blot
citations: 2
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
product information
cat no :
AV40382
brand :
SIGMA
name :
Anti-GRSF1 antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_001091947
syns :
Anti-FLJ13125; Anti-G-rich RNA sequence binding factor 1
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
bovine, human, mouse, rat
immunogen :
synthetic peptide corresponding to a region of human GRSF1 with an internal ID of P22126
immunogen sequence :
NGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMG
QRYVEVYEINN
QRYVEVYEINN
company information

MilliporeSigma
questions and comments
