Anti-ACTB antibody produced in rabbit | MilliporeSigma AV40173 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-ACTB antibody produced in rabbit

catalog :

AV40173

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

citations: 3

Published Application/Species/Sample/Dilution	Reference
western blot; human; fig 1	Castaño J, Morera C, Sesé B, Boue S, Bonet Costa C, Marti M, et al. SETD7 Regulates the Differentiation of Human Embryonic Stem Cells. PLoS ONE. 2016;11:e0149502 pubmed publisher
western blot; human; 1:1000; fig 3, 4	Tu G, Zhang Y, Wei W, Li L, Zhang Y, Yang J, et al. Allicin attenuates Hâ‚‚Oâ‚‚-induced cytotoxicity in retinal pigmented epithelial cells by regulating the levels of reactive oxygen species. Mol Med Rep. 2016;13:2320-6 pubmed publisher
	Fisher M, Rivera Reyes A, Bloch N, Schatz D, Bassing C. Immature Lymphocytes Inhibit Rag1 and Rag2 Transcription and V(D)J Recombination in Response to DNA Double-Strand Breaks. J Immunol. 2017;198:2943-2956 pubmed publisher

product information

cat no :

AV40173

brand :

SIGMA

name :

Anti-ACTB antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_001092

syns :

Anti-Actin, beta; Anti-Beta-actin; Anti-PS1TP5BP1

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

human

immunogen :

synthetic peptide corresponding to a region of human ACTB with an internal ID of P22019

immunogen sequence :

GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHG
IVTNWDDMEKI