This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-SAP18 antibody produced in rabbit
catalog :
AV38690
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dog, chicken, cow, zebrafish
application :
western blot
product information
cat no :
AV38690
brand :
SIGMA
name :
Anti-SAP18 antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
ncbi accession no :
NP_005861
syns :
Anti-Sin3A-associated protein, 18 kDa
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
chicken, zebrafish, human, mouse, rat, canine, bovine
immunogen :
synthetic peptide corresponding to a region of human SAP18 with an internal ID of P20879
immunogen sequence :
EKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSE
LQIYTWMDATL
LQIYTWMDATL
company information

MilliporeSigma
questions and comments
