Anti-PIAS4 antibody produced in rabbit | MilliporeSigma AV33011 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-PIAS4 antibody produced in rabbit

catalog :

AV33011

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:1000; loading ...; fig s8a	He Z, Zhang J, Huang Z, Du Q, Li N, Zhang Q, et al. Sumoylation of RORγt regulates TH17 differentiation and thymocyte development. Nat Commun. 2018;9:4870 pubmed publisher

product information

cat no :

AV33011

brand :

SIGMA

name :

Anti-PIAS4 antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

ncbi accession no :

NP_056981

syns :

Anti-Protein inhibitor of activated STAT, 4

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

, canine, bovine, human, mouse, rat, zebrafish

immunogen :

synthetic peptide corresponding to a region of human PIAS4 with an internal ID of P04040

immunogen sequence :

AAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVT
RALQLVQFDCS

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.