This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IL21 Receptor Antibody (aa35-64) LS-C83985
catalog :
LS-C83985
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
immunohistochemistry, flow cytometry
product information
AntibodyID :
84884
AntibodyName :
LS-C83985
TargetSpecies :
Mouse
Host Species :
Rabbit
Product Name :
IL21 Receptor Antibody (aa35-64) LS-C83985
Specificity :
This F(ab')2 antibody recognizes mouse interleukin-21 receptor and the peptide sequence is less than 50% similar to other sequences in GenBank in this region. CI0156 was not tested for cross-reactivity to human IL-21 receptor.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa35-64
PresentationDesc :
10 mM Potassium Phosphate, 140 mM NaCl, 1 mg/ml BSA, 0.1% Sodium Azide
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-Terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%).
PurificationDesc :
Immunoaffinity purified
RecommendedStorageDesc :
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Gene :
IL21 Receptor
StandardGeneSymbol :
IL21R
gene family :
Interleukin
Reactivity :
Mouse
Usage :
ELISA (1:50000), Flo (1:25), IHC (1:250)
ShortWebDescription :
IL21 Receptor antibody LS-C83985 is an unconjugated rabbit polyclonal antibody to mouse IL21 Receptor (aa35-64). Validated for ELISA, Flow and IHC.
Synonyms :
IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments