This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IL-22BP / IL22RA2 Antibody (aa33-60) LS-C83979
catalog :
LS-C83979
clonality :
polyclonal
host :
domestic goat
conjugate :
nonconjugated
reactivity :
human
product information
AntibodyID :
84878
AntibodyName :
LS-C83979
TargetSpecies :
Human
Host Species :
Goat
Product Name :
IL-22BP / IL22RA2 Antibody (aa33-60) LS-C83979
Specificity :
This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa33-60
PresentationDesc :
10mM KHPO4, 140mM NaCl, 1mg/ml BSA, 0.1% sodium azide
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-Terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (96%); Marmoset (89%); Dog (82%).
PurificationDesc :
Immunoaffinity purified
RecommendedStorageDesc :
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Gene :
IL-22BP / IL22RA2
StandardGeneSymbol :
IL22RA2
Reactivity :
Human, Monkey
Usage :
ELISA (1:50000)
UsageNotRecommended :
IHC-P
ShortWebDescription :
IL22RA2 antibody LS-C83979 is an unconjugated goat polyclonal antibody to IL22RA2 (IL-22BP) (aa33-60) from human. It is reactive with human and monkey. Validated for ELISA.
UsageText :
ELISA: Peptide-based assay to confirm the ability of the antibody to recognize the immunogenic peptide.
Synonyms :
IL22RA2, Class II cytokine receptor, IL-22BP, IL-22RA2, IL-22R-alpha-2, Interleukin 22-binding protein, Interleukin-22-binding protein, CRF2-10, CRF2-S1, CRF2X, IL-22 receptor subunit alpha-2, IL22BP, ZcytoR16
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.