product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
CD274 / B7-H1 / PD-L1 Antibody LS-C746930
catalog :
LS-C746930
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry
more info or order :
citations: 1
product information
AntibodyID :
772527
AntibodyName :
LS-C746930
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
CD274 / B7-H1 / PD-L1 Antibody LS-C746930
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
ImmunogenType :
Recombinant protein
ImmunogenDesc :
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYW
EMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGN
AALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYN
KINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQV
LSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRR
LDPEENHTAELVIPELPLAHPPNER
Recombinant fusion protein containing a sequence corresponding to amino acids 19-238 of human CD274 (NP_054862.1).
EMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGN
AALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYN
KINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQV
LSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRR
LDPEENHTAELVIPELPLAHPPNER
Recombinant fusion protein containing a sequence corresponding to amino acids 19-238 of human CD274 (NP_054862.1).
PurificationDesc :
Affinity purified
RecommendedStorageDesc :
Store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG
Gene :
CD274 / B7-H1 / PD-L1
StandardGeneSymbol :
CD274
Reactivity :
Mouse, Rat, Human
Usage :
IF (1:20 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
ShortWebDescription :
PD-L1 antibody LS-C746930 is an unconjugated rabbit polyclonal antibody to PD-L1 (CD274 / B7-H1) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Cited in 1 publication.
UsageText :
The predicted MW is 20kDa/33kDa, while the observed MW by Western blot was 45kDa.
Synonyms :
CD274, B7-H, B7 homolog 1, B7-H1, B7H1, CD274 molecule, CD274 antigen, PDCD1 ligand 1, PDL1, PD-L1, PDCD1L1, PDCD1LG1, Programmed death ligand 1
SalesRegion :
Worldwide
more info or order :
company information

LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
related products
browse more products
questions and comments
