product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
IGFBP3 Antibody (aa214-252) LS-C407922
catalog :
LS-C407922
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
LifeSpan Biosciences product webpage
citations: 1
Published Application/Species/Sample/DilutionReference
  • western blot; human
Lui J, Garrison P, Nguyen Q, Ad M, Keembiyehetty C, Chen W, et al. EZH1 and EZH2 promote skeletal growth by repressing inhibitors of chondrocyte proliferation and hypertrophy. Nat Commun. 2016;7:13685 pubmed publisher
image
image 1 :
LifeSpan Biosciences LS-C407922 image 1
IGFBP3 antibody Western blot. All lanes: Anti IGFBP3 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: Rat Liver Tissue Lysate at 50 ug. Lane 3: SGC Whole Cell Lysate at 40 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Predicted band size: 31 kD. Observed band size: 31 kD.
image 2 :
LifeSpan Biosciences LS-C407922 image 2
IGFBP3 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
product information
AntibodyID :
420286
AntibodyName :
LS-C407922
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
IGFBP3 Antibody (aa214-252) LS-C407922
Specificity :
Expressed by most tissues. Present in plasma.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa214-252
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the C-Terminus of human IGFBP-3 (214-252 aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
IGFBP3
StandardGeneSymbol :
IGFBP3
Reactivity :
Rat, Human
Usage :
ELISA (0.1 - 0.5 µg/ml), IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml)
ShortWebDescription :
IGFBP3 antibody LS-C407922 is an unconjugated rabbit polyclonal antibody to IGFBP3 (aa214-252) from human. It is reactive with human and rat. Validated for ELISA, IHC and WB. Cited in 1 publication.
UsageText :
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Synonyms :
IGFBP3, Binding protein 29, Binding protein 53, BP-53, IGF-binding protein 3, IGFBP-3, IBP-3, IBP3
SalesRegion :
Worldwide
more info or order :
LifeSpan Biosciences product webpage
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.