product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
LYZ / Lysozyme Antibody (aa106-141) LS-C407874
catalog :
LS-C407874
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
product information
AntibodyID :
420238
AntibodyName :
LS-C407874
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
LYZ / Lysozyme Antibody (aa106-141) LS-C407874
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa106-141
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the C-Terminus of human Lysozyme (106-141 aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
LYZ / Lysozyme
StandardGeneSymbol :
LYZ
Reactivity :
Rat, Human
Usage :
IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml)
ShortWebDescription :
Lysozyme antibody LS-C407874 is an unconjugated rabbit polyclonal antibody to Lysozyme (LYZ) (aa106-141) from human. It is reactive with human and rat. Validated for IHC and WB. Cited in 1 publication.
UsageText :
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Synonyms :
LYZ, 1,4-beta-N-acetylmuramidase C, LZM, Lysozyme, Lysozyme (renal amyloidosis), Renal amyloidosis, Lysozyme C, Gal d 4, P00698
SalesRegion :
Worldwide
more info or order :
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
browse more products
questions and comments