This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
HSPA2 Antibody (aa564-598) LS-C407851
catalog :
LS-C407851
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
420215
AntibodyName :
LS-C407851
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
HSPA2 Antibody (aa564-598) LS-C407851
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa564-598
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
HSPA2
StandardGeneSymbol :
HSPA2
Reactivity :
Mouse, Dog, Rat, Hamster, Pig, Human
Usage :
IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml)
ShortWebDescription :
HSPA2 antibody LS-C407851 is an unconjugated rabbit polyclonal antibody to HSPA2 (aa564-598) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
UsageText :
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Synonyms :
HSPA2, Heat shock 70kD protein 2, HSP70-2, HSP70-3, Heat shock 70 kDa protein 2, Heat shock 70kDa protein 2
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.