product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
EPHB1 / EPH Receptor B1 Antibody (aa56-88) LS-C407798
catalog :
LS-C407798
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
image
image 1 :

Eph receptor B1 antibody Western blot. All lanes: Anti Eph receptor B1 at 0.5 ug/ml. WB: 293T Whole Cell Lysate at 40 ug. Predicted band size: 111 kD. Observed band size: 111 kD.
image 2 :

Eph receptor B1 antibody IHC-paraffin. IHC(P): Human Glioma Tissue.
product information
AntibodyID :
420162
AntibodyName :
LS-C407798
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
EPHB1 / EPH Receptor B1 Antibody (aa56-88) LS-C407798
Specificity :
Preferentially expressed in brain.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa56-88
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the N-Terminus of human Eph receptor B1 (56-88 aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
EPHB1 / EPH Receptor B1
StandardGeneSymbol :
EPHB1
gene family :
Protein Kinase
Subfamily :
Ephrin Receptor
Reactivity :
Chicken, Sheep, Bovine, Rat, Pig, Horse, Bat, Mouse, Guinea pig, Human
Usage :
IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml)
ShortWebDescription :
EPH Receptor B1 antibody LS-C407798 is an unconjugated rabbit polyclonal antibody to EPH Receptor B1 (EPHB1) (aa56-88) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB. Cited in 1 publication.
UsageText :
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Synonyms :
EPHB1, Cek6, EK6, ELK, Ephrin type-B receptor 1, Hek6, EPHT2, NET, EPH receptor B1, EPH tyrosine kinase 2, EPH-like kinase 6, Soluble EPHB1 variant 1
SalesRegion :
Worldwide
more info or order :
company information

LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
related products
browse more products
- FGF2 / Basic FGF Antibody (aa219-249) LS-C407800 | LS-C407800
- HTR2B / 5-HT2B Receptor Antibody (aa446-478) LS-C407814 | LS-C407814
- IDO1 / IDO Antibody (aa37-69) LS-C407816 | LS-C407816
- LCN2 / Lipocalin 2 / NGAL Antibody (aa21-200) LS-C407821 | LS-C407821
- SFTPD / Surfactant Protein D Antibody (aa292-321) LS-C407829 | LS-C407829
questions and comments