product summary
Loading...
company name :
LifeSpan Biosciences
product type :
antibody
product name :
VIL1 / Villin Antibody (aa770-799) LS-C407669
catalog :
LS-C407669
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
LifeSpan Biosciences product webpage
citations: 2
Reference
Nakhoul N, Thawko T, Farber E, Dahan I, Tadmor H, Nakhoul R, et al. The Therapeutic Effect of Active Vitamin D Supplementation in Preventing the Progression of Diabetic Nephropathy in a Diabetic Mouse Model. J Diabetes Res. 2020;2020:7907605 pubmed publisher
Liu Y, Cromeens B, Wang Y, Fisher K, Johnson J, Chakroff J, et al. Comparison of Different in vivo Incubation Sites to Produce Tissue Engineered Small Intestine. Tissue Eng Part A. 2018;: pubmed publisher
product information
AntibodyID :
420033
AntibodyName :
LS-C407669
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
VIL1 / Villin Antibody (aa770-799) LS-C407669
Specificity :
Specifically expressed in epithelial cells. Major component of microvilli of intestinal epithelial cells and kidney proximal tubule cells. Expressed in canalicular microvilli of hepatocytes (at protein level).
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa770-799
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the C-Terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
VIL1 / Villin
StandardGeneSymbol :
VIL1
Reactivity :
Mouse, Rat, Human
Usage :
IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml)
ShortWebDescription :
Villin antibody LS-C407669 is an unconjugated rabbit polyclonal antibody to Villin (VIL1) (aa770-799) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Cited in 2 publications.
UsageText :
WB: The detection limit for Villin is approximately 0.1 ng/lane under reducing conditions. IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Synonyms :
VIL1, D2S1471, Villin, Villin 1, Villin-1, VIL
SalesRegion :
Worldwide
more info or order :
LifeSpan Biosciences product webpage
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.