This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
HPSE / Heparanase Antibody (aa301-331) LS-C407641
catalog :
LS-C407641
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
AntibodyID :
420005
AntibodyName :
LS-C407641
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
HPSE / Heparanase Antibody (aa301-331) LS-C407641
Specificity :
Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues. Also expressed in hair follicles, specifically in both Henle's and Huxley's layers of inner the root sheath (IRS) at anagen phase.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa301-331
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
ImmunogenDesc :
A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331 aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
HPSE / Heparanase
StandardGeneSymbol :
HPSE
Reactivity :
Rat, Human
Usage :
WB (0.1 - 0.5 µg/ml)
ShortWebDescription :
Heparanase antibody LS-C407641 is an unconjugated rabbit polyclonal antibody to Heparanase (HPSE) (aa301-331) from human. It is reactive with human and rat. Validated for WB.
Synonyms :
HPSE, Endo-glucoronidase, Heparanase-1, Heparanase, HPA, HSE1, HEP, HPA1, HPSE1, HPR1
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com
1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.