This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
ATP2A2 / SERCA2 Antibody (aa1-32) LS-C357605
catalog :
LS-C357605
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
368929
AntibodyName :
LS-C357605
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
ATP2A2 / SERCA2 Antibody (aa1-32) LS-C357605
Specificity :
Isoform 1 is widely expressed in smooth muscle and nonmuscle tissues such as in adult skin epidermis, with highest expression in liver, pancreas and lung, and intermediate expression in brain, kidney and placenta. Also expressed at lower levels in heart and skeletal muscle. Isoforms 2 and 3 are highly expressed in the heart and slow twitch skeletal muscle. Expression of isoform 3 is predominantly restricted to cardiomyocytes and in close proximity to the sarcolemma. Both isoforms are mildly expressed in lung, kidney, liver, pancreas and placenta. Expression of isoform 3 is amplified during monocytic differentiation and also observed in the fetal heart.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa1-32
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the N-Terminus of human SERCA2 ATPase (1-32 aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
ATP2A2 / SERCA2
StandardGeneSymbol :
ATP2A2
gene family :
Transporter
Subfamily :
ATPase - P type, type IIA
Reactivity :
Rabbit, Mouse, Dog, Guinea pig, Sheep, Bovine, Rat, Pig, Horse, Gibbon, Chimpanzee, Human, Monkey
Usage :
IHC, IHC-P, WB
ShortWebDescription :
SERCA2 antibody LS-C357605 is an unconjugated rabbit polyclonal antibody to SERCA2 (ATP2A2) (aa1-32) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Synonyms :
ATP2A2, ATP2B, Calcium pump 2, DAR, SR Ca(2+)-ATPase 2, Cardiac Ca2+ ATPase, DD, SERCA2
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
