This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
SMN1 Antibody (aa22-52) LS-C357585
catalog :
LS-C357585
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
AntibodyID :
368909
AntibodyName :
LS-C357585
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
SMN1 Antibody (aa22-52) LS-C357585
Specificity :
Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level).
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa22-52
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the N-Terminus of human SMN1/2(22-52 aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
SMN1
StandardGeneSymbol :
SMN1
Reactivity :
Rabbit, Mouse, Dog, Rat, Chimpanzee, Human, Monkey
Usage :
IHC, IHC-P, WB
ShortWebDescription :
SMN1 antibody LS-C357585 is an unconjugated rabbit polyclonal antibody to SMN1 (aa22-52) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Synonyms :
SMN1, BCD541, Component of gems 1, Gemin-1, SMA2, SMA4, SMA@, SMA1, SMNC, SMNT, T-BCD541, SMN, Survival motor neuron protein, Gemin 1, GEMIN1, SMA, SMA3
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments