This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
PIM1 / Pim-1 Antibody (aa373-404) LS-C357504
catalog :
LS-C357504
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
AntibodyID :
368828
AntibodyName :
LS-C357504
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
PIM1 / Pim-1 Antibody (aa373-404) LS-C357504
Specificity :
Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines.
ClonalityDesc :
Polyclonal
AntibodyModification :
Unconjugated
AntigenModification :
aa373-404
PresentationDesc :
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
ImmunogenDesc :
A synthetic peptide corresponding to a sequence at the C-Terminus of human PIM1(373-404 aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.
PurificationDesc :
Immunogen affinity purified
RecommendedStorageDesc :
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Gene :
PIM1 / Pim-1
StandardGeneSymbol :
PIM1
gene family :
Protein Kinase
Subfamily :
PIM
Reactivity :
Sheep, Horse, Gibbon, Human, Monkey, Chimpanzee
Usage :
WB
ShortWebDescription :
Pim-1 antibody LS-C357504 is an unconjugated rabbit polyclonal antibody to Pim-1 (PIM1) (aa373-404) from human. It is reactive with human, chimpanzee, gibbon and other species. Validated for WB.
Synonyms :
PIM1, Pim-1 kinase 44 kDa isoform, Proviral integration site 1, Oncogene PIM1, PIM, Pim-1, Pim-1 oncogene
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments