This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
STXBP1 / MUNC18-1 Antibody (clone 1B9) LS-C348219
catalog :
LS-C348219
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B9
reactivity :
human
application :
western blot, ELISA
product information
AntibodyID :
359176
AntibodyName :
LS-C348219
TargetSpecies :
Human
Host Species :
Mouse
Product Name :
STXBP1 / MUNC18-1 Antibody (clone 1B9) LS-C348219
Specificity :
Munc18-1
ClonalityDesc :
Monoclonal
CloneName :
1B9
AntibodyModification :
Unconjugated
PresentationDesc :
PBS, 0.02% Sodium Azide
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
NTGEKTTMRQIPPEDSEIIVTDSTLRRRSISTRSSASFS
DLRHPDFRESSFEDQAPTME.
Munc18-1 fusion peptide with the following sequence: HKAQMKNPILM
DLRHPDFRESSFEDQAPTME.
Munc18-1 fusion peptide with the following sequence: HKAQMKNPILM
PurificationDesc :
Protein G purified
RecommendedStorageDesc :
Short term: store at 4°C. Long term: store at -20°C. Avoid freeze-thaw cycles.
IsotypeName :
IgG2b,k
Gene :
STXBP1 / MUNC18-1
StandardGeneSymbol :
STXBP1
Reactivity :
Human
Usage :
ELISA, WB
ShortWebDescription :
MUNC18-1 antibody LS-C348219 is an unconjugated mouse monoclonal antibody to human MUNC18-1 (STXBP1). Validated for ELISA and WB.
UsageText :
This antibody is suitable for use in Western Blot (recommended dilution: 1:100) and ELISA (recommended dilution: 1:64000).
Synonyms :
STXBP1, EIEE4, HUNC18, MUNC18-1, N-Sec1, NSEC1, Protein unc-18 homolog 1, Protein unc-18 homolog A, UNC18, Unc18-1, p67, RBSEC1, Unc-18A, Munc18, Neuronal SEC1, Syntaxin binding protein 1, Syntaxin-binding protein 1, UNC18A
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments
