This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
LifeSpan Biosciences
product type :
antibody
product name :
HSPD1 / HSP60 Antibody (Preservative Free, Biotin) LS-C343493
catalog :
LS-C343493
clonality :
polyclonal
host :
domestic rabbit
conjugate :
biotin
reactivity :
human
product information
AntibodyID :
354333
AntibodyName :
LS-C343493
TargetSpecies :
Human
Host Species :
Rabbit
Product Name :
HSPD1 / HSP60 Antibody (Preservative Free, Biotin) LS-C343493
Specificity :
The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat HSP60 has not yet been tested.
ClonalityDesc :
Polyclonal
AntibodyModification :
Preservative Free, Biotin
PresentationDesc :
Lyophilized from PBS, No preservatives added
ImmunogenType :
Synthetic peptide
ImmunogenDesc :
Synthetic peptide derived from human HSP60. Immunogen Sequence: CAIATGGAVFGEEGLTLNLEDVQPHDLGK.
PurificationDesc :
Protein A + Protein G affinity chromatography
RecommendedStorageDesc :
Short term: Store at 4 °C for 1 month. Long term: Store at -20°C to -70°C for up to 1 year. Avoid freeze-thaw cycles.
ResuspensionLiquidDesc :
Sterile buffer.
IsotypeName :
IgG
Gene :
HSPD1 / HSP60
StandardGeneSymbol :
HSPD1
Reactivity :
Human
Usage :
ELISA (1:64000)
ShortWebDescription :
HSP60 antibody LS-C343493 is a biotin-conjugated rabbit polyclonal antibody to human HSP60 (HSPD1). Validated for ELISA.
UsageText :
The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.
Synonyms :
HSPD1, 60 kDa chaperonin, CPN60, Heat shock protein 65, Heat shock protein 60, HSP-60, HSP60, HuCHA60, HLD4, HSP65, p60 lymphocyte protein, SPG13, Chaperonin 60, GROEL
SalesRegion :
Worldwide
company information
LifeSpan Biosciences
2401 Fourth Avenue, Suite 900
Seattle, WA 98121
Seattle, WA 98121
CustomerSupport@lsbio.com
https://www.lsbio.com1-206-464-1554
headquarters: USA
Since 1995, LifeSpan has been the industry leader in molecular pathology, specializing in the localization of proteins in normal and diseased tissues, both human and non-human. We offer more than 74,000 antibodies, custom designed immunohistochemistry (IHC) studies, immediately available human tissue IHC profiles for more than 500 proteins, and histology and pathology services. Our bank of 2 million specimens is available to support our customers' contract research studies and contains frozen and formalin-fixed (FFPE) normal and diseased tissues. Our contract services are comprehensive; they include study design, antibody sourcing and characterization, tissue sourcing and validation, immunolabeling, trouble shooting, and interpretation of the results by a LifeSpan pathologist.
questions and comments